Magic

King Of Solace icon

King Of Solace

[Book One in the Blades of Fate Trilogy] (Achievement displayed on the sticker of this book is from a wattpad competition. Shay spencer's featured author. The rest of this book can also be read there, though, in its unedited form.) Would you really g
Popularity:246 ★4.3
Young Adversary icon

Young Adversary

What if there was a world where every being of legends and myth existed? I mean the likes of Zeus, Thor, Lucifer, King Arthur, Amaterasu, Sun Wukong, and every being who throughout history was created by or linked to widely believed myths. What if that wo
Popularity:468 ★4.3
The Codex Of Creatures icon

The Codex Of Creatures

Under the desert hot sun to the tangled branches of green forests. From the cold peaks of mountains to the dark depths of oceans. What an extraordinary our world is, full of mysteries and wonders, Yet brutal and merciless. This is the codex of creatures,
Popularity:451 ★4.3
Lorctbvrorpgiraadhesgiaclswintrashwmdlsamygiadwimtdkagmactbapdsbihtaoatln?! icon

Lorctbvrorpgiraadhesgiaclswintrashwmdlsamygiadwimtdkagmactbapdsbihtaoatln?!

Legend of Re: Class Transfer Betrayal VR Online RPG - I reincarnated as a Divine Heavenly Emperor Sword God into a Cultivation Labyrinth System where I NTR'd a slave harem with my disciple little sister and my Yandere girlfriend in a Dungeon where I met
Popularity:352 ★4.3
The Black Healing Holy Beast ~Is What It Is Exaggeratedly Called but It Is Just a Black Rabbit~ icon

The Black Healing Holy Beast ~Is What It Is Exaggeratedly Called but It Is Just a Black Rabbit~

When I realized it, I had been reborn as a rabbit. The carnivores, the associated threat to the herbivores, were not present in our habitat in the forest. That's why I was careless. Carnivores were not the only dangers. One day, all the rabbits in the
Popularity:289 ★3.8
Myriad Domain icon

Myriad Domain

This is a fantasy novel involving all races and different forms of power. Gods, ghosts, bloodlines, magic, and magic weapons all exist here. The novel takes place at first during the era of the gods and opens up with the first chapter 200 years after the
Popularity:255 ★4.3
The Caring Dungeon icon

The Caring Dungeon

NOTE: I, as an 'author' am on a(n) (indefinite?) Hiatus. Without getting into too many details, the person who convinced me to write, who was my muse and my everything, is no longer in my life. I think about writing and I get physically ill and ache in
Popularity:304 ★4.3